Recombinant Human CEMP1 Protein (1-247 aa), His-tagged
Cat.No. : | CEMP1-1682H |
Product Overview : | Recombinant Human CEMP1 Protein (1-247 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-247 aa |
Description : | MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 28.0 kDa |
AA Sequence : | MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | CEMP1 cementum protein 1 [ Homo sapiens (human) ] |
Official Symbol | CEMP1 |
Synonyms | CP23; CP-23; |
Gene ID | 752014 |
mRNA Refseq | NM_001048212 |
Protein Refseq | NP_001041677 |
UniProt ID | Q6PRD7 |
◆ Recombinant Proteins | ||
CEMP1-6879HF | Recombinant Full Length Human CEMP1 Protein, GST-tagged | +Inquiry |
CEMP1-1683H | Recombinant Human CEMP1 protein, His-tagged | +Inquiry |
CEMP1-1682H | Recombinant Human CEMP1 Protein (1-247 aa), His-tagged | +Inquiry |
CEMP1-18H | Recombinant Human CEMP1, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEMP1 Products
Required fields are marked with *
My Review for All CEMP1 Products
Required fields are marked with *
0
Inquiry Basket