Recombinant Human CELA3B protein, GST-tagged

• Cat.No.: CELA3B-256H
• Product Overview: Recombinant Human CELA3B(19 a.a. - 270 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 53.46 kDa
• AA Sequence: GPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSWTYQVVLGEYDRAVK EGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTN GPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFG CNTRRKPTVFTRVSAFIDWIEETIASH
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 19-270 a.a.

Gene Information

• Gene Name: CELA3B chymotrypsin-like elastase family, member 3B [ Homo sapiens ]
• Official Symbol: CELA3B
• Synonyms: CELA3B; chymotrypsin-like elastase family, member 3B; ELA3B, elastase 3B, pancreatic; chymotrypsin-like elastase family member 3B; CBPP; cholesterol binding pancreatic protease; elastase 1; pancreatic endopeptidase E; proteinase E; protease E; elastase-3B; elastase IIIB; fecal elastase 1; pancreatic elastase 1; elastase 3B, pancreatic; cholesterol-binding pancreatic protease; E1; EL-1; ELA3B
• Gene ID: 23436
• mRNA Refseq: NM_007352
• Protein Refseq: NP_031378
• UniProt ID: P08861
• Chromosome Location: 1p36.12
• Pathway: Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem
• Function: peptidase activity; serine-type endopeptidase activity