Recombinant Human CELA3B, His-tagged

Cat.No. : CELA3B-65H
Product Overview : Recombinant Human Chymotrypsin-Like Elastase Family Member 3B/CELA3B is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Val29-His270) of Human CELA3B fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Chymotrypsin-Like Elastase Family Member 3B (CELA3B) is an enzyme that belongs to the peptidase S1 family of Elastase subfamily. CELA3B contains one peptidase S1 domain. CELA3B is expressed in the pancreas, but it is not detected in keratinocytes. CELA3B is secreted from the pancreas as a zymogen. CELA3B is an efficient protease with alanine specificity but only little elastolytic activity. CELA3B has a digestive function in the intestine. CELA3B preferentially cleaves proteins after alanine residues. CELA3B may also function in the intestinal transport and metabolism of cholesterol.
Source : HEK293
Species : Human
Tag : His
AA Sequence : VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSWTYQVVLGEYDRAVK EGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCY ITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNC PTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASHVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Protein length : 29-270 a.a.
Gene Name CELA3B chymotrypsin-like elastase family, member 3B [ Homo sapiens ]
Official Symbol CELA3B
Synonyms CELA3B; chymotrypsin-like elastase family, member 3B; ELA3B, elastase 3B, pancreatic; chymotrypsin-like elastase family member 3B; CBPP; cholesterol binding pancreatic protease; elastase 1; pancreatic endopeptidase E; proteinase E; protease E; elastase-3B; elastase IIIB; fecal elastase 1; pancreatic elastase 1; elastase 3B, pancreatic; cholesterol-binding pancreatic protease; E1; EL-1; ELA3B;
Gene ID 23436
mRNA Refseq NM_007352
Protein Refseq NP_031378
UniProt ID P08861
Chromosome Location 1p36.12
Pathway Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem;
Function peptidase activity; serine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CELA3B Products

Required fields are marked with *

My Review for All CELA3B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon