Recombinant Human CEBPG Protein, GST-Tagged

Description :	The C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein: a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. The C/EBP family consist of several related proteins, C/EBP alpha, C/EBP beta, C/EBP gamma, and C/EBP delta, that form homodimers and that form heterodimers with each other. CCAAT/enhancer binding protein gamma may cooperate with Fos to bind PRE-I enhancer elements. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Nov 2011]
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	42.24 kDa
AA Sequence :	MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	CEBPG CCAAT/enhancer binding protein (C/EBP), gamma [ Homo sapiens ]
Official Symbol	CEBPG
Synonyms	CEBPG; CCAAT/enhancer binding protein (C/EBP), gamma; CCAAT/enhancer-binding protein gamma; GPE1BP; IG/EBP 1; c/EBP gamma; IG/EBP-1;
Gene ID	1054
mRNA Refseq	NM_001252296
Protein Refseq	NP_001239225
MIM	138972
UniProt ID	P53567