Recombinant Human CEBPE Protein, GST-Tagged

• Cat.No.: CEBPE-1104H
• Product Overview: Human CEBPE full-length ORF (AAH35797.2, 1 a.a. - 281 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal differentiation and functional maturation of committed granulocyte progenitor cells. Mutations in this gene have been associated with Specific Granule Deficiency, a rare congenital disorder. Multiple variants of this gene have been described, but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008]
• Molecular Mass: 56.65 kDa
• AA Sequence: MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CEBPE CCAAT/enhancer binding protein (C/EBP), epsilon [ Homo sapiens ]
• Official Symbol: CEBPE
• Synonyms: CEBPE; CCAAT/enhancer binding protein (C/EBP), epsilon; CCAAT/enhancer-binding protein epsilon; CRP1; c/EBP epsilon; C/EBP-epsilon
• Gene ID: 1053
• mRNA Refseq: NM_001805
• Protein Refseq: NP_001796
• MIM: 600749
• UniProt ID: Q15744