Recombinant Human CEBPB, His-tagged

• Cat.No.: CEBPB-27010TH
• Product Overview: Recombinant fragment, corresponding to amino acids 125-345 of Human CEBP Beta with N terminal His tag; Predicted MWt 26 kDa.

Specification

• Description: The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related proteins CEBP-alpha, CEBP-delta, and CEBP-gamma. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses and has been shown to bind to the IL-1 response element in the IL-6 gene, as well as to regulatory regions of several acute-phase and cytokine genes. In addition, the encoded protein can bind the promoter and upstream element and stimulate the expression of the collagen type I gene.
• Conjugation: HIS
• Source: E. coli
• Tissue specificity: Expressed at low levels in the lung, kidney and spleen.
• Form: Lyophilised:Reconstitute with 85 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPP PPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAG FPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPAD AKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRR ERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC
• Sequence Similarities: Belongs to the bZIP family. C/EBP subfamily.Contains 1 bZIP domain.
• Protein length: 125-345 a.a.

Gene Information

• Gene Name: CEBPB CCAAT/enhancer binding protein (C/EBP), beta [ Homo sapiens ]
• Official Symbol: CEBPB
• Synonyms: CEBPB; CCAAT/enhancer binding protein (C/EBP), beta; TCF5; CCAAT/enhancer-binding protein beta; C/EBP beta; CRP2; IL6DBP; interleukin 6 dependent DNA binding protein; LAP; liver enriched transcriptional activator protein; NFIL6; nuclear factor of interleu
• Gene ID: 1051
• mRNA Refseq: NM_005194
• Protein Refseq: NP_005185
• MIM: 189965
• Uniprot ID: P17676
• Chromosome Location: 20q13.1
• Pathway: Adipogenesis, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diurnally regulated genes with circadian orthologs, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem
• Function: DNA binding; glucocorticoid receptor binding; protein binding; protein heterodimerization activity; protein homodimerization activity