Recombinant Human CEACAM5 protein(321-410 aa), C-His-tagged

• Cat.No.: CEACAM5-2568H
• Product Overview: Recombinant Human CEACAM5 protein(P06731)(321-410 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 321-410 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 12.5 kDa
• AASequence: EPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILN
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: CEACAM5 carcinoembryonic antigen-related cell adhesion molecule 5 [ Homo sapiens ]
• Official Symbol: CEACAM5
• Synonyms: CEACAM5; carcinoembryonic antigen-related cell adhesion molecule 5; CEA; CD66e; meconium antigen 100; DKFZp781M2392
• Gene ID: 1048
• mRNA Refseq: NM_004363
• Protein Refseq: NP_004354
• MIM: 114890
• UniProt ID: P06731