Recombinant Human CEACAM3 Protein, His-SUMO-tagged

• Cat.No.: CEACAM3-1160H
• Product Overview: Recombinant Human CEACAM3 Protein (35-155aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag.

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 29.1 kDa
• AA Sequence: KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTN
  ASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Protein length: 35-155 a.a.

Gene Information

• Gene Name: CEACAM3 carcinoembryonic antigen-related cell adhesion molecule 3 [ Homo sapiens ]
• Official Symbol: CEACAM3
• Synonyms: CEACAM3; carcinoembryonic antigen-related cell adhesion molecule 3; CD66d antigen; OTTHUMP00000196409; carcinoembryonic antigen CGM1; carcinoembryonic antigen gene family member 1; nonspecific cross-reacting antigen; CEA; CGM1; W264; W282; CD66D; MGC119875
• Gene ID: 1084
• mRNA Refseq: NM_001815
• Protein Refseq: NP_001806
• MIM: 609142
• UniProt ID: P40198