Recombinant Human CEACAM1 protein(151-230 aa), C-His-tagged
Cat.No. : | CEACAM1-2650H |
Product Overview : | Recombinant Human CEACAM1 protein(P13688)(151-230 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 151-230 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVT |
Gene Name | CEACAM1 carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein) [ Homo sapiens ] |
Official Symbol | CEACAM1 |
Synonyms | CEACAM1; carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein); BGP; carcinoembryonic antigen-related cell adhesion molecule 1; BGP1; CD66a; antigen CD66; CD66a antigen; BGPI; |
Gene ID | 634 |
mRNA Refseq | NM_001024912 |
Protein Refseq | NP_001020083 |
MIM | 109770 |
UniProt ID | P13688 |
◆ Recombinant Proteins | ||
CEACAM1-6372Z | Recombinant Zebrafish CEACAM1 | +Inquiry |
CEACAM1-0846H | Recombinant Human CEACAM1 Protein (Gln35-Glu320), His tagged | +Inquiry |
Ceacam1-8740R | Recombinant Rat Ceacam1 protein(Met1-Ser422), His-tagged | +Inquiry |
CEACAM1-11079H | Recombinant Human CEACAM1, His-tagged | +Inquiry |
Ceacam1-3312MAF555 | Recombinant Mouse Ceacam1 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM1-3039HCL | Recombinant Human CEACAM1 cell lysate | +Inquiry |
CEACAM1-1239RCL | Recombinant Rat CEACAM1 cell lysate | +Inquiry |
CEACAM1-2214MCL | Recombinant Mouse CEACAM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEACAM1 Products
Required fields are marked with *
My Review for All CEACAM1 Products
Required fields are marked with *
0
Inquiry Basket