Recombinant Human CDSN Protein, GST-Tagged

• Cat.No.: CDSN-1079H
• Product Overview: Human CDSN partial ORF (NP_001255, 306 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein found in corneodesmosomes, which localize to human epidermis and other cornified squamous epithelia. The encoded protein undergoes a series of cleavages during corneocyte maturation. This gene is highly polymorphic in human populations, and variation has been associated with skin diseases such as psoriasis, hypotrichosis and peeling skin syndrome. The gene is located in the major histocompatibility complex (MHC) class I region on chromosome 6. [provided by RefSeq, Dec 2014]
• Molecular Mass: 31.24 kDa
• AA Sequence: YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDSN corneodesmosin [ Homo sapiens ]
• Official Symbol: CDSN
• Synonyms: CDSN; corneodesmosin; D6S586E; differentiated keratinocyte S protein; S; PSS; HTSS; HTSS1
• Gene ID: 1041
• mRNA Refseq: NM_001264
• Protein Refseq: NP_001255
• MIM: 602593
• UniProt ID: Q15517