Recombinant Human CDRT15 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CDRT15-2437H
• Product Overview: CDRT15 MS Standard C13 and N15-labeled recombinant protein (NP_001007531) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: CDRT15 (CMT1A Duplicated Region Transcript 15) is a Protein Coding gene. Diseases associated with CDRT15 include Charcot-Marie-Tooth Disease. An important paralog of this gene is CDRT15L2.
• Molecular Mass: 20.5 kDa
• AA Sequence: MFSCCFPTSRGCCFRNGGSESLFRRCRRRLIPHPRRLSPVVIRRIQVPQDSLGQALAGQATPEIPLGLQLHTVLVQEIQELIEAQTLAPGPCAEVRALPAPAAEPEPAWEEAPPERALELEGAPAKDQTNEELPEITEVPESIKRRLGRRVPAATPAPRGNLLLQAWMRVHSWASRLFAPNVLPGTGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CDRT15 CMT1A duplicated region transcript 15 [ Homo sapiens (human) ]
• Official Symbol: CDRT15
• Synonyms: CDRT15; CMT1A duplicated region transcript 15; CMT1A duplicated region transcript 15 protein
• Gene ID: 146822
• mRNA Refseq: NM_001007530
• Protein Refseq: NP_001007531
• UniProt ID: Q96T59