Recombinant Human CDR2 Protein, GST-Tagged

• Cat.No.: CDR2-1072H
• Product Overview: Human CDR2 full-length ORF (AAH17503, 1 a.a. - 454 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CDR2 (Cerebellar Degeneration Related Protein 2) is a Protein Coding gene. Diseases associated with CDR2 include Cerebellar Degeneration and Paraneoplastic Cerebellar Degeneration. An important paralog of this gene is CDR2L.
• Molecular Mass: 75.68 kDa
• AA Sequence: MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDR2 cerebellar degeneration-related protein 2, 62kDa [ Homo sapiens ]
• Official Symbol: CDR2
• Synonyms: CDR2; cerebellar degeneration-related protein 2, 62kDa; cerebellar degeneration related protein (62kD); cerebellar degeneration-related protein 2; CDR62; Yo; Yo paraneoplastic antigen; major Yo paraneoplastic antigen; paraneoplastic cerebellar degeneration-associated antigen
• Gene ID: 1039
• mRNA Refseq: NM_001802
• Protein Refseq: NP_001793
• MIM: 117340
• UniProt ID: Q01850