Recombinant Human CDPF1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CDPF1-6525H
• Product Overview: C22orf40 MS Standard C13 and N15-labeled recombinant protein (NP_997210) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: CDPF1 (Cysteine Rich DPF Motif Domain Containing 1) is a Protein Coding gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 13.9 kDa
• AA Sequence: MASHVECRPLGVFECELCTLTAPYSYVGQKPPNTQSMVLLEESYVMKDPFTSDKDRFLVLGSCCSLCSRLVCVGPECSLFYSKRFCLPCVRENINAFPQEIRQDLEKRKAPSKRTPSQPGSRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CDPF1 cysteine rich DPF motif domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: CDPF1
• Synonyms: CDPF1; cysteine rich DPF motif domain containing 1; C22orf40; cysteine-rich DPF motif domain-containing protein 1; UPF0595 protein C22orf40
• Gene ID: 150383
• mRNA Refseq: NM_207327
• Protein Refseq: NP_997210
• UniProt ID: Q6NVV7