Recombinant Human CDON Protein, GST-Tagged

Description :	This gene encodes a cell surface receptor that is a member of the immunoglobulin superfamily. The encoded protein contains three fibronectin type III domains and five immunoglobulin-like C2-type domains. This protein is a member of a cell-surface receptor complex that mediates cell-cell interactions between muscle precursor cells and positively regulates myogenesis. [provided by RefSeq, Aug 2011]
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	37.73 kDa
AA Sequence :	VKVPVCLTSAVPDCGQLPEESVKDNVEPVPTQRTCCQDIVNDVSSDGSEDPAEFSRGDSCAHSETEINIVSWNALILPPVPEGCAEKTMWSPPGIPLDSPTEVLQQPRE
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	CDON Cdon homolog (mouse) [ Homo sapiens ]
Official Symbol	CDON
Synonyms	CDON; Cdon homolog (mouse); cell adhesion molecule related/down regulated by oncogenes; cell adhesion molecule-related/down-regulated by oncogenes; CDO; ORCAM; surface glycoprotein, Ig superfamily member; HPE11; MGC111524;
Gene ID	50937
mRNA Refseq	NM_001243597
Protein Refseq	NP_001230526
MIM	608707
UniProt ID	Q4KMG0