Recombinant Human CDON Protein, GST-Tagged

Cat.No. : CDON-1071H
Product Overview : Human CDON partial ORF (NP_058648, 1155 a.a. - 1263 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a cell surface receptor that is a member of the immunoglobulin superfamily. The encoded protein contains three fibronectin type III domains and five immunoglobulin-like C2-type domains. This protein is a member of a cell-surface receptor complex that mediates cell-cell interactions between muscle precursor cells and positively regulates myogenesis. [provided by RefSeq, Aug 2011]
Molecular Mass : 37.73 kDa
AA Sequence : VKVPVCLTSAVPDCGQLPEESVKDNVEPVPTQRTCCQDIVNDVSSDGSEDPAEFSRGDSCAHSETEINIVSWNALILPPVPEGCAEKTMWSPPGIPLDSPTEVLQQPRE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDON Cdon homolog (mouse) [ Homo sapiens ]
Official Symbol CDON
Synonyms CDON; Cdon homolog (mouse); cell adhesion molecule related/down regulated by oncogenes; cell adhesion molecule-related/down-regulated by oncogenes; CDO; ORCAM; surface glycoprotein, Ig superfamily member; HPE11; MGC111524;
Gene ID 50937
mRNA Refseq NM_001243597
Protein Refseq NP_001230526
MIM 608707
UniProt ID Q4KMG0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDON Products

Required fields are marked with *

My Review for All CDON Products

Required fields are marked with *

0

Inquiry Basket

cartIcon