Recombinant Human CDON Protein, GST-Tagged

• Cat.No.: CDON-1071H
• Product Overview: Human CDON partial ORF (NP_058648, 1155 a.a. - 1263 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a cell surface receptor that is a member of the immunoglobulin superfamily. The encoded protein contains three fibronectin type III domains and five immunoglobulin-like C2-type domains. This protein is a member of a cell-surface receptor complex that mediates cell-cell interactions between muscle precursor cells and positively regulates myogenesis. [provided by RefSeq, Aug 2011]
• Molecular Mass: 37.73 kDa
• AA Sequence: VKVPVCLTSAVPDCGQLPEESVKDNVEPVPTQRTCCQDIVNDVSSDGSEDPAEFSRGDSCAHSETEINIVSWNALILPPVPEGCAEKTMWSPPGIPLDSPTEVLQQPRE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDON Cdon homolog (mouse) [ Homo sapiens ]
• Official Symbol: CDON
• Synonyms: CDON; Cdon homolog (mouse); cell adhesion molecule related/down regulated by oncogenes; cell adhesion molecule-related/down-regulated by oncogenes; CDO; ORCAM; surface glycoprotein, Ig superfamily member; HPE11; MGC111524
• Gene ID: 50937
• mRNA Refseq: NM_001243597
• Protein Refseq: NP_001230526
• MIM: 608707
• UniProt ID: Q4KMG0