Recombinant Human CDO1 Protein, GST-Tagged

• Cat.No.: CDO1-1069H
• Product Overview: Human CDO1 full-length ORF (NP_001792.2, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CDO1 (Cysteine Dioxygenase Type 1) is a Protein Coding gene. Diseases associated with CDO1 include Hepatoblastoma. Among its related pathways are Viral mRNA Translation and Sulfur amino acid metabolism. GO annotations related to this gene include iron ion binding and cysteamine dioxygenase activity.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 49.4 kDa
• AA Sequence: MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDO1 cysteine dioxygenase, type I [ Homo sapiens ]
• Official Symbol: CDO1
• Synonyms: CDO1; cysteine dioxygenase, type I; cysteine dioxygenase type 1; CDO; CDO-I
• Gene ID: 1036
• mRNA Refseq: NM_001801
• Protein Refseq: NP_001792
• MIM: 603943
• UniProt ID: Q16878