Recombinant Human CDNF Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CDNF-5915H
• Product Overview: CDNF MS Standard C13 and N15-labeled recombinant protein (NP_001025125) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: CDNF (Cerebral Dopamine Neurotrophic Factor) is a Protein Coding gene. Diseases associated with CDNF include Baritosis and Indolent Systemic Mastocytosis. Gene Ontology (GO) annotations related to this gene include growth factor activity. An important paralog of this gene is MANF.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 21 kDa
• AA Sequence: MWCASPVAVVAFCAGLLVSHPVLTQGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CDNF cerebral dopamine neurotrophic factor [ Homo sapiens (human) ]
• Official Symbol: CDNF
• Synonyms: CDNF; cerebral dopamine neurotrophic factor; arginine rich, mutated in early stage tumors like 1, ARMETL1; conserved dopamine neurotrophic factor; ARMET-like protein 1; arginine-rich, mutated in early stage tumors-like 1; ARMETL1
• Gene ID: 441549
• mRNA Refseq: NM_001029954
• Protein Refseq: NP_001025125
• MIM: 611233
• UniProt ID: Q49AH0