Recombinant Rat Cdnf protein

Cat.No. : Cdnf-231R
Product Overview : Recombinant Rat Cdnf protein was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 163
Description : Trophic factor for dopamine neurons. Prevents the 6-hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra.
Form : Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. It is able to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons when immobilized at 5 - 25 µg/mL on a nitrocellulose-coated microplate.
Molecular Mass : Approximately 18.8 kDa, a single non-glycosylated polypeptide chain containing 163 amino acids.
AA Sequence : QGLEAGVRSRADCEVCKEFLNRFYNSLLTRGIDFSVDTIEEELISFCADTKGKENRLCYYLGATKDSATKILGEVTRPMSVHMPTVKICEKLKKMDSQICELKYEKKLDLESVDLWKMRVAELKQILHSWGEECRACAEKHDYVNLIKELAPKYVETRPQTEL
Endotoxin : Less than 0.1 EU/µg of rRtCDNF as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Cdnf
Official Symbol Cdnf
Synonyms CDNF; cerebral dopamine neurotrophic factor; ARMET-like protein 1; conserved dopamine neurotrophic factor; arginine-rich, mutated in early stage tumors-like 1; arginine-rich protein mutated in early stage tumors-like 1; Armetl1;
Gene ID 361276
mRNA Refseq NM_001037543
Protein Refseq NP_001032632
UniProt ID P0C5I0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Cdnf Products

Required fields are marked with *

My Review for All Cdnf Products

Required fields are marked with *

0

Inquiry Basket

cartIcon