Recombinant Rat Cdnf protein

• Cat.No.: Cdnf-231R
• Product Overview: Recombinant Rat Cdnf protein was expressed in E.coli.

Specification

• Description: Trophic factor for dopamine neurons. Prevents the 6-hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra.
• Source: E.coli
• Species: Rat
• Form: Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. It is able to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons when immobilized at 5 - 25 µg/mL on a nitrocellulose-coated microplate.
• Molecular Mass: Approximately 18.8 kDa, a single non-glycosylated polypeptide chain containing 163 amino acids.
• Protein length: 163
• AA Sequence: QGLEAGVRSRADCEVCKEFLNRFYNSLLTRGIDFSVDTIEEELISFCADTKGKENRLCYYLGATKDSATKILGEVTRPMSVHMPTVKICEKLKKMDSQICELKYEKKLDLESVDLWKMRVAELKQILHSWGEECRACAEKHDYVNLIKELAPKYVETRPQTEL
• Endotoxin: Less than 0.1 EU/µg of rRtCDNF as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: Cdnf
• Official Symbol: Cdnf
• Synonyms: CDNF; cerebral dopamine neurotrophic factor; ARMET-like protein 1; conserved dopamine neurotrophic factor; arginine-rich, mutated in early stage tumors-like 1; arginine-rich protein mutated in early stage tumors-like 1; Armetl1
• Gene ID: 361276
• mRNA Refseq: NM_001037543
• Protein Refseq: NP_001032632
• UniProt ID: P0C5I0