Recombinant Human CDKN1C Protein, GST-Tagged

• Cat.No.: CDKN1C-1059H
• Product Overview: Human CDKN1C partial ORF (NP_000067, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is imprinted, with preferential expression of the maternal allele. The encoded protein is a tight-binding, strong inhibitor of several G1 cyclin/Cdk complexes and a negative regulator of cell proliferation. Mutations in this gene are implicated in sporadic cancers and Beckwith-Wiedemann syndorome, suggesting that this gene is a tumor suppressor candidate. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Oct 2010]
• Molecular Mass: 36.74 kDa
• AA Sequence: MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDKN1C cyclin-dependent kinase inhibitor 1C (p57, Kip2) [ Homo sapiens ]
• Official Symbol: CDKN1C
• Synonyms: CDKN1C; cyclin-dependent kinase inhibitor 1C (p57, Kip2); Beckwith Wiedemann syndrome, BWCR, BWS; cyclin-dependent kinase inhibitor 1C; KIP2; P57; p57Kip2; cyclin-dependent kinase inhibitor p57; BWS; WBS; p57; BWCR
• Gene ID: 1028
• mRNA Refseq: NM_000076
• Protein Refseq: NP_000067
• MIM: 600856
• UniProt ID: P49918