Recombinant Human CDKL4 Protein, GST-Tagged

• Cat.No.: CDKL4-1051H
• Product Overview: Human CDKL4 partial ORF (AAV63975, 196 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CDKL4 (Cyclin Dependent Kinase Like 4) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CDKL1.
• Molecular Mass: 36.63 kDa
• AA Sequence: TGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFKSNGFFHGISIPEPEDMETLEEKFSDVHPVALNFMKGCLKMNPDDRLTCSQLLESSYFDSFQEAQIK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDKL4 cyclin-dependent kinase-like 4 [ Homo sapiens ]
• Official Symbol: CDKL4
• Synonyms: CDKL4; cyclin-dependent kinase-like 4
• Gene ID: 344387
• mRNA Refseq: NM_001009565
• Protein Refseq: NP_001009565
• UniProt ID: Q5MAI5