Recombinant Human CDK2AP2 Protein, GST-Tagged

• Cat.No.: CDK2AP2-1006H
• Product Overview: Human CDK2AP2 full-length ORF (AAH02850.1, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein that interacts with cyclin-dependent kinase 2 associated protein 1. Pseudogenes associated with this gene are located on chromosomes 7 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2012]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 39.49 kDa
• AA Sequence: MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDK2AP2 cyclin-dependent kinase 2 associated protein 2 [ Homo sapiens ]
• Official Symbol: CDK2AP2
• Synonyms: CDK2AP2; cyclin-dependent kinase 2 associated protein 2; CDK2 associated protein 2; cyclin-dependent kinase 2-associated protein 2; DOC 1R; p14; tumor suppressor deleted in oral cancer related 1; DOC-1-related protein; CDK2-associated protein 2; tumor suppressor deleted in oral cancer-related 1; DOC-1R; FLJ10636
• Gene ID: 10263
• mRNA Refseq: NM_005851
• Protein Refseq: NP_005842
• UniProt ID: O75956