Recombinant Human CDK11A Protein, GST-Tagged

• Cat.No.: CDK11A-0922H
• Product Overview: Human CDK11A partial ORF (NP_277073, 681 a.a. - 780 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the serine/threonine protein kinase family. Members of this kinase family are known to be essential for eukaryotic cell cycle control. Due to a segmental duplication, this gene shares very high sequence identity with a neighboring gene. These two genes are frequently deleted or altered in neuroblastoma. The protein kinase encoded by this gene can be cleaved by caspases and may play a role in cell apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
• Molecular Mass: 36.63 kDa
• AA Sequence: GFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDK11A cyclin dependent kinase 11A [ Homo sapiens (human) ]
• Official Symbol: CDK11A
• Synonyms: CDK11A; cyclin dependent kinase 11A; CDC2L2; cell division cycle 2-like 2 (PITSLRE proteins); CDC2L2, CDC2L3, cell division cycle 2 like 2, cell division cycle 2 like 2 (PITSLRE proteins); cell division cycle 2-like 2; CDK11 p46; CDK11 p58; CDK11 p110; p58GTA; PITSLRE; CDC2L3; CDK11-p46; CDK11-p58; CDK11-p110; MGC131975; cyclin-dependent kinase 11A; PITSLRE B; PITSLRE protein kinase beta SV1 isoform; PITSLRE protein kinase beta SV16 isoform; PITSLRE protein kinase beta SV17 isoform; PITSLRE protein kinase beta SV18 isoform; PITSLRE protein kinase beta SV2 isoform; PITSLRE protein kinase beta SV3 isoform; PITSLRE protein kinase beta SV6 isoform; PITSLRE serine/threonine-protein kinase CDC2L2; cell division cycle 2-like 2 (PITSLRE proteins); cell division cycle 2-like protein kinase 2; cell division protein kinase 11A; galactosyltransferase-associated protein kinase p58/GTA; EC 2.7.11.22
• Gene ID: 728642
• mRNA Refseq: NM_001313896
• Protein Refseq: NP_001300825
• MIM: 116951
• UniProt ID: Q9UQ88