Recombinant Human CDHR4 Protein

• Cat.No.: CDHR4-5256H
• Product Overview: Human CDHR4 full-length ORF (ADR82858.1) recombinant protein without tag.

Specification

• Description: CDHR4 (Cadherin Related Family Member 4) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is CDHR3.
• Source: Wheat Germ
• Species: Human
• Form: Liquid
• Molecular Mass: 21.9 kDa
• AA Sequence: MVLLRLLVFLFAPVVSDLCSLPCFINVSESQGPGTVLQFLSFNCSSYTPTPTLELLNVQPPTTFFNPPSLARWQGTYVGKLTLSSSAQLDALMVNHYKVQLKFTCGNHVMEGSLSVDVQRDLSHIQCAGQFASPGEARGSRQGGGRHGLSRSSLTSTLASWGNDSGARDSHTWGSAVHSAPPRPRTPRSAGKPRTWDGG
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Tag: Non

Gene Information

• Gene Name: CDHR4 cadherin related family member 4 [ Homo sapiens (human) ]
• Official Symbol: CDHR4
• Synonyms: CDHR4; cadherin related family member 4; CDH29; PRO34300; cadherin-related family member 4; Cadherin-like protein UNQ9392/PRO34300; VLLR9392; cadherin-like 29; cadherin-like protein 29
• Gene ID: 389118
• mRNA Refseq: NM_001007540
• Protein Refseq: NP_001007541
• UniProt ID: A6H8M9