Recombinant Human CDH4 protein(761-840 aa), C-His-tagged

• Cat.No.: CDH4-2788H
• Product Overview: Recombinant Human CDH4 protein(P55283)(761-840 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 761-840 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: KERHTKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPEAMGHVPSKAPGVRRVDERPVGAEPQYPIRPMVPHPG
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: CDH4 cadherin 4, type 1, R-cadherin (retinal) [ Homo sapiens ]
• Official Symbol: CDH4
• Synonyms: CDH4; cadherin 4, type 1, R-cadherin (retinal); cadherin-4; R Cadherin; R-CAD; R-cadherin; retinal cadherin; cadherin 4, type 1, preproprotein; CAD4; RCAD; FLJ22202; FLJ40547; MGC126700; MGC138355
• Gene ID: 1002
• mRNA Refseq: NM_001252338
• Protein Refseq: NP_001239267
• MIM: 603006
• UniProt ID: P55283