Recombinant Human CDH4 protein(761-840 aa), C-His-tagged

Cat.No. : CDH4-2788H
Product Overview : Recombinant Human CDH4 protein(P55283)(761-840 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 761-840 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : KERHTKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPEAMGHVPSKAPGVRRVDERPVGAEPQYPIRPMVPHPG
Gene Name CDH4 cadherin 4, type 1, R-cadherin (retinal) [ Homo sapiens ]
Official Symbol CDH4
Synonyms CDH4; cadherin 4, type 1, R-cadherin (retinal); cadherin-4; R Cadherin; R-CAD; R-cadherin; retinal cadherin; cadherin 4, type 1, preproprotein; CAD4; RCAD; FLJ22202; FLJ40547; MGC126700; MGC138355;
Gene ID 1002
mRNA Refseq NM_001252338
Protein Refseq NP_001239267
MIM 603006
UniProt ID P55283

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDH4 Products

Required fields are marked with *

My Review for All CDH4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon