Recombinant Human CDH4 protein(761-840 aa), C-His-tagged
Cat.No. : | CDH4-2788H |
Product Overview : | Recombinant Human CDH4 protein(P55283)(761-840 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 761-840 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KERHTKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPEAMGHVPSKAPGVRRVDERPVGAEPQYPIRPMVPHPG |
Gene Name | CDH4 cadherin 4, type 1, R-cadherin (retinal) [ Homo sapiens ] |
Official Symbol | CDH4 |
Synonyms | CDH4; cadherin 4, type 1, R-cadherin (retinal); cadherin-4; R Cadherin; R-CAD; R-cadherin; retinal cadherin; cadherin 4, type 1, preproprotein; CAD4; RCAD; FLJ22202; FLJ40547; MGC126700; MGC138355; |
Gene ID | 1002 |
mRNA Refseq | NM_001252338 |
Protein Refseq | NP_001239267 |
MIM | 603006 |
UniProt ID | P55283 |
◆ Recombinant Proteins | ||
CDH4-601H | Recombinant Human CDH4 protein, His-tagged | +Inquiry |
CDH4-1397H | Recombinant Human CDH4 Protein (Leu667-Asp916), N-GST tagged | +Inquiry |
CDH4-4271Z | Recombinant Zebrafish CDH4 | +Inquiry |
CDH4-1210C | Recombinant Chicken CDH4 | +Inquiry |
CDH4-2788H | Recombinant Human CDH4 protein(761-840 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH4-2723HCL | Recombinant Human CDH4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDH4 Products
Required fields are marked with *
My Review for All CDH4 Products
Required fields are marked with *
0
Inquiry Basket