Recombinant Human CDH3 protein(681-780 aa), C-His-tagged

Cat.No. : CDH3-2696H
Product Overview : Recombinant Human CDH3 protein(P22223)(681-780 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 681-780 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : RKIKEPLLLPEDDTRDNVFYYGEEGGGEEDQDYDITQLHRGLEARPEVVLRNDVAPTIIPTPMYRPRPANPDEIGNFIIENLKAANTDPTAPPYDTLLVF
Gene Name CDH3 cadherin 3, type 1, P-cadherin (placental) [ Homo sapiens ]
Official Symbol CDH3
Synonyms CDH3; cadherin 3, type 1, P-cadherin (placental); cadherin 3, P cadherin (placental); cadherin-3; CDHP; PCAD; calcium-dependent adhesion protein, placental; HJMD;
Gene ID 1001
mRNA Refseq NM_001793
Protein Refseq NP_001784
MIM 114021
UniProt ID P22223

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDH3 Products

Required fields are marked with *

My Review for All CDH3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon