Recombinant Human CDH15 protein, T7/His-tagged

• Cat.No.: CDH15-50H
• Product Overview: Recombinant human CDH15 (61– 246aa, derived from BC008951) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 61-246 a.a.
• Form: 2.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFLPYPLVQIKSDKQQLGSVIYSIQGPGVDEEPRGVFSIDKFTGKVFL NAMLDREKTDRFRLRAFALDLGGSTLEDPTDLEIVVVDQNDNRPAFLQEAFTGRVLEGAVPGTYVTRAEATDADD PETDNAALRFSILQQGSPELFSIDELTGEIRTVQVGLDREVVAVYNLTLQVADMSGDGLTATASAWAHNSRNLVA AALRVVAVAVVVAAVAN
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro CDH15 N-termianl mediated myogenesis regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as CDH15 N-terminal Cadherin domain protein-protein interaction assay.3. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: CDH15 cadherin 15, type 1, M-cadherin (myotubule) [ Homo sapiens ]
• Official Symbol: CDH15
• Synonyms: CDH15; cadherin 15, type 1, M-cadherin (myotubule); cadherin 15, M cadherin (myotubule) , CDH3, CDH14; cadherin-15; cadherin-3; cadherin-14; muscle-cadherin; CDH3; CDHM; MCAD; MRD3; CDH14
• Gene ID: 1013
• mRNA Refseq: NM_004933
• Protein Refseq: NP_004924
• MIM: 114019
• UniProt ID: P55291
• Chromosome Location: 16q24.3
• Pathway: Adherens junctions interactions, organism-specific biosystem; CDO in myogenesis, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem
• Function: calcium ion binding