Recombinant Human CDH15 protein, T7/His-tagged
| Cat.No. : | CDH15-50H |
| Product Overview : | Recombinant human CDH15 (61– 246aa, derived from BC008951) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E. coli |
| Species : | Human |
| Tag : | His&T7 |
| Form : | 2.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFLPYPLVQIKSDKQQLGSVIYSIQGPGVDEEPRGVFSIDKFTGKVFL NAMLDREKTDRFRLRAFALDLGGSTLEDPTDLEIVVVDQNDNRPAFLQEAFTGRVLEGAVPGTYVTRAEATDADD PETDNAALRFSILQQGSPELFSIDELTGEIRTVQVGLDREVVAVYNLTLQVADMSGDGLTATASAWAHNSRNLVA AALRVVAVAVVVAAVAN |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro CDH15 N-termianl mediated myogenesis regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as CDH15 N-terminal Cadherin domain protein-protein interaction assay.3. As antigen for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Protein length : | 61-246 a.a. |
| Gene Name | CDH15 cadherin 15, type 1, M-cadherin (myotubule) [ Homo sapiens ] |
| Official Symbol | CDH15 |
| Synonyms | CDH15; cadherin 15, type 1, M-cadherin (myotubule); cadherin 15, M cadherin (myotubule) , CDH3, CDH14; cadherin-15; cadherin-3; cadherin-14; muscle-cadherin; CDH3; CDHM; MCAD; MRD3; CDH14; |
| Gene ID | 1013 |
| mRNA Refseq | NM_004933 |
| Protein Refseq | NP_004924 |
| MIM | 114019 |
| UniProt ID | P55291 |
| Chromosome Location | 16q24.3 |
| Pathway | Adherens junctions interactions, organism-specific biosystem; CDO in myogenesis, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
| Function | calcium ion binding; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDH15 Products
Required fields are marked with *
My Review for All CDH15 Products
Required fields are marked with *
0
Inquiry Basket
