Recombinant Human CDH1, StrepII-tagged
Cat.No. : | CDH1-278H |
Product Overview : | Purified human recombinant CDH1 (CADH1) protein (amino acids 731-882, 152 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 17.1 kDa. (Accession NP_004351.1; UniProt P12830) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 731-882, 152 a.a. |
Description : | This product is the intracellular domain of CDH1. Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. CDH1 is involved in mechanisms regulating cell-cell adhesions, mobility and proliferation of epithelial cells. Has a potent invasive suppressor role. It is a ligand for integrin alpha-E/beta-7. CDH1 is a homodimer comprised of five extracellular cadherin repeats, a transmembrane region, and a highly conserved cytoplasmic tail. Mutations in this gene are correlated with gastric, breast, colorectal, thyroid, and ovarian cancer. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free) |
AA Sequence : | LRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPD EIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGE DD |
Endotoxin : | <0.1 eu per μg protein by lal |
Purity : | >90% by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month |
Gene Name | CDH1 cadherin 1, type 1, E-cadherin (epithelial) [ Homo sapiens ] |
Official Symbol | CDH1 |
Synonyms | CDH1; cadherin 1, type 1, E-cadherin (epithelial); UVO; cadherin-1; CD324; E Cadherin; uvomorulin; CAM 120/80; E-Cadherin; cell-CAM 120/80; epithelial cadherin; cadherin 1, E-cadherin (epithelial); calcium-dependent adhesion protein, epithelial; CDHE; ECAD; LCAM; Arc-1; |
Gene ID | 999 |
mRNA Refseq | NM_004360 |
Protein Refseq | NP_004351 |
MIM | 192090 |
UniProt ID | P12830 |
Chromosome Location | 16q22.1 |
Pathway | Adaptive Immune System, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Adherens junctions interactions, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptotic cleavage of cell adhesionproteins, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem; |
Function | GTPase activating protein binding; calcium ion binding; cell adhesion molecule binding; gamma-catenin binding; protein binding; |
◆ Recombinant Proteins | ||
CDH1-946R | Recombinant Rat CDH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cdh1-8756R | Recombinant Rat Cdh1 protein, hFc-tagged | +Inquiry |
CDH1-3135HF | Recombinant Full Length Human CDH1 Protein, GST-tagged | +Inquiry |
CDH1-0976H | Recombinant Human CDH1 Protein (Asp155-Ile707), C-His tagged | +Inquiry |
CDH1-43H | Recombinant Human CDH1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH1-938HCL | Recombinant Human CDH1 cell lysate | +Inquiry |
CDH1-1892MCL | Recombinant Mouse CDH1 cell lysate | +Inquiry |
CDH1-736RCL | Recombinant Rat CDH1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDH1 Products
Required fields are marked with *
My Review for All CDH1 Products
Required fields are marked with *
0
Inquiry Basket