Recombinant Human CDH1, StrepII-tagged

• Cat.No.: CDH1-278H
• Product Overview: Purified human recombinant CDH1 (CADH1) protein (amino acids 731-882, 152 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 17.1 kDa. (Accession NP_004351.1; UniProt P12830)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 731-882, 152 a.a.
• Description: This product is the intracellular domain of CDH1. Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. CDH1 is involved in mechanisms regulating cell-cell adhesions, mobility and proliferation of epithelial cells. Has a potent invasive suppressor role. It is a ligand for integrin alpha-E/beta-7. CDH1 is a homodimer comprised of five extracellular cadherin repeats, a transmembrane region, and a highly conserved cytoplasmic tail. Mutations in this gene are correlated with gastric, breast, colorectal, thyroid, and ovarian cancer.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
• AA Sequence: LRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPD EIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGE DD
• Endotoxin: <0.1 eu per μg protein by lal
• Purity: >90% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month

Gene Information

• Gene Name: CDH1 cadherin 1, type 1, E-cadherin (epithelial) [ Homo sapiens ]
• Official Symbol: CDH1
• Synonyms: CDH1; cadherin 1, type 1, E-cadherin (epithelial); UVO; cadherin-1; CD324; E Cadherin; uvomorulin; CAM 120/80; E-Cadherin; cell-CAM 120/80; epithelial cadherin; cadherin 1, E-cadherin (epithelial); calcium-dependent adhesion protein, epithelial; CDHE; ECAD; LCAM; Arc-1
• Gene ID: 999
• mRNA Refseq: NM_004360
• Protein Refseq: NP_004351
• MIM: 192090
• UniProt ID: P12830
• Chromosome Location: 16q22.1
• Pathway: Adaptive Immune System, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Adherens junctions interactions, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptotic cleavage of cell adhesionproteins, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem
• Function: GTPase activating protein binding; calcium ion binding; cell adhesion molecule binding; gamma-catenin binding; protein binding