Recombinant Human CDCA5 Protein, GST-Tagged

• Cat.No.: CDCA5-0962H
• Product Overview: Human CDCA5 full-length ORF (NP_542399.1, 1 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CDCA5 (Cell Division Cycle Associated 5) is a Protein Coding gene. Among its related pathways are CDK-mediated phosphorylation and removal of Cdc6 and Mitotic Metaphase and Anaphase. GO annotations related to this gene include chromatin binding.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 54 kDa
• AA Sequence: MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDCA5 cell division cycle associated 5 [ Homo sapiens ]
• Official Symbol: CDCA5
• Synonyms: CDCA5; cell division cycle associated 5; sororin; p35; cell division cycle-associated protein 5; SORORIN; MGC16386
• Gene ID: 113130
• mRNA Refseq: NM_080668
• Protein Refseq: NP_542399
• MIM: 609374
• UniProt ID: Q96FF9