Recombinant Human CDC6, GST-tagged
Cat.No. : | CDC6-96H |
Product Overview : | Recombinant human CDC6 encoding human CDC6 partial ORF (434a.a. - 533 a.a.) produced in in vitro wheat germ expression system, was fuseda GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is highlysimilar to Saccharomyces cerevisiae Cdc6, a protein essential for theinitiation of DNA replication. This protein functions as a regulator at theearly steps of DNA replication. It localizes in cell nucleus during cell cyleG1, but translocates to the cytoplasm at the start of S phase. Thesubcellular translocation of this protein during cell cyle is regulatedthrough its phosphorylation by Cdks. Transcription of this protein wasreported to be regulated in response to mitogenic signals throughtranscriptional control mechanism involving E2F proteins. |
Sequence : | ISQVISEVDGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQLKIKEVTLGKLYEAYSKVCRKQQVAAVDQSECLSLSGLLEARGILGLKRNKETRLTKVF |
Purification : | GlutathioneSepharose 4 Fast Flow |
Molecular Weight : | 36.74 kDa |
Applications : | ELISA;WB |
StorageBuffer : | 50 mM Tris-HCI, 10mM reduced Glutathione, pH8.0 in the elution buffer. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CDC6cell division cycle 6 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | CDC6 |
Synonyms | CDC6; cell division cycle 6 homolog (S. cerevisiae);CDC18L; HsCDC6; HsCDC18; CDC6 (cell division cycle 6, S. cerevisiae) homolog;CDC6 cell division cycle 6 homolog (S. cerevisiae); Cell division controlprotein 6 homolog; p62(cdc6); CDC18 (cell division cycle 18, S.pombe,homolog)-like; homolog; CDC6 cell division cycle 6 homo; CDC6-relatedprotein; cell division cycle 6 homolog (S. cerevisiae); cell division cycle 6protein |
Gene ID | 990 |
mRNA Refseq | NM_001254 |
Protein Refseq | NP_001245 |
MIM | 602627 |
UniProt ID | Q99741 |
Chromosome Location | 17q21.3 |
Pathway | Activation of ATRin response to replication stress; Cell Cycle, Mitotic; DNA Replication |
◆ Recombinant Proteins | ||
CDC6-1493M | Recombinant Mouse CDC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDC6-11018H | Recombinant Human CDC6, GST-tagged | +Inquiry |
CDC6-6781Z | Recombinant Zebrafish CDC6 | +Inquiry |
CDC6-022H | Recombinant Human CDC6 Protein, His-tagged | +Inquiry |
CDC6-96H | Recombinant Human CDC6, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC6-7647HCL | Recombinant Human CDC6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDC6 Products
Required fields are marked with *
My Review for All CDC6 Products
Required fields are marked with *
0
Inquiry Basket