Recombinant Human CDC42SE2 Protein, GST-tagged
Cat.No. : | CDC42SE2-5176H |
Product Overview : | Human CDC42SE2 partial ORF ( NP_064625, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CDC42SE2 (CDC42 Small Effector 2) is a Protein Coding gene. Diseases associated with CDC42SE2 include Schizophrenia. GO annotations related to this gene include structural molecule activity. An important paralog of this gene is CDC42SE1. |
Molecular Mass : | 34.98 kDa |
AA Sequence : | MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDC42SE2 CDC42 small effector 2 [ Homo sapiens (human) ] |
Official Symbol | CDC42SE2 |
Synonyms | CDC42SE2; CDC42SE2; CDC42 small effector 2; SPEC2; CDC42 small effector protein 2; non-kinase Cdc42 effector protein SPEC2; small effector of CDC42 protein 2 |
Gene ID | 56990 |
mRNA Refseq | NM_001038702 |
Protein Refseq | NP_001033791 |
UniProt ID | Q9NRR3 |
◆ Recombinant Proteins | ||
CDC42SE2-402H | Recombinant Human CDC42SE2 Protein, His-tagged | +Inquiry |
CDC42SE2-1492M | Recombinant Mouse CDC42SE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDC42SE2-3149M | Recombinant Mouse CDC42SE2 Protein | +Inquiry |
CDC42SE2-5609C | Recombinant Chicken CDC42SE2 | +Inquiry |
CDC42SE2-5176H | Recombinant Human CDC42SE2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC42SE2-7650HCL | Recombinant Human CDC42SE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDC42SE2 Products
Required fields are marked with *
My Review for All CDC42SE2 Products
Required fields are marked with *
0
Inquiry Basket