Recombinant Human CDC42SE2 Protein, GST-tagged

• Cat.No.: CDC42SE2-5176H
• Product Overview: Human CDC42SE2 partial ORF ( NP_064625, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CDC42SE2 (CDC42 Small Effector 2) is a Protein Coding gene. Diseases associated with CDC42SE2 include Schizophrenia. GO annotations related to this gene include structural molecule activity. An important paralog of this gene is CDC42SE1.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 34.98 kDa
• AA Sequence: MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDC42SE2 CDC42 small effector 2 [ Homo sapiens (human) ]
• Official Symbol: CDC42SE2
• Synonyms: CDC42SE2; CDC42SE2; CDC42 small effector 2; SPEC2; CDC42 small effector protein 2; non-kinase Cdc42 effector protein SPEC2; small effector of CDC42 protein 2
• Gene ID: 56990
• mRNA Refseq: NM_001038702
• Protein Refseq: NP_001033791
• UniProt ID: Q9NRR3