Recombinant Human CDC42BPA Protein, GST-Tagged

Cat.No. : CDC42BPA-0939H
Product Overview : Human CDC42BPA partial ORF (NP_003598, 551 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the Serine/Threonine protein kinase family. This kinase contains multiple functional domains. Its kinase domain is highly similar to that of the myotonic dystrophy protein kinase (DMPK). This kinase also contains a Rac interactive binding (CRIB) domain, and has been shown to bind CDC42. It may function as a CDC42 downstream effector mediating CDC42 induced peripheral actin formation, and promoting cytoskeletal reorganization. Multiple alternatively spliced transcript variants have been described, and the full-length nature of two of them has been reported. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.63 kDa
AA Sequence : LVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKVESLRQELRRTERAKKELEVHTEALAAEASKDRKLRE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDC42BPA CDC42 binding protein kinase alpha (DMPK-like) [ Homo sapiens ]
Official Symbol CDC42BPA
Synonyms CDC42BPA; CDC42 binding protein kinase alpha (DMPK-like); CDC42 binding protein kinase alpha (DMPK like); serine/threonine-protein kinase MRCK alpha; FLJ23347; KIAA0451; MRCK; MRCKA; myotonic dystrophy kinase related Cdc42 binding kinase; PK428; MRCK alpha; DMPK-like alpha; ser-thr protein kinase PK428; CDC42 binidng protein kinase beta; myotonic dystrophy protein kinase-like alpha; CDC42-binding protein kinase alpha (DMPK-like); myotonic dystrophy kinase-related CDC42-binding kinase alpha; myotonic dystrophy kinase-related CDC42-binding protein kinase alpha; ser-thr protein kinase related to the myotonic dystrophy protein kinase; DKFZp686L1738; DKFZp686P1738;
Gene ID 8476
mRNA Refseq NM_003607
Protein Refseq NP_003598
MIM 603412
UniProt ID Q5VT25

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDC42BPA Products

Required fields are marked with *

My Review for All CDC42BPA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon