Recombinant Human CDC42BPA Protein, GST-Tagged

• Cat.No.: CDC42BPA-0939H
• Product Overview: Human CDC42BPA partial ORF (NP_003598, 551 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of the Serine/Threonine protein kinase family. This kinase contains multiple functional domains. Its kinase domain is highly similar to that of the myotonic dystrophy protein kinase (DMPK). This kinase also contains a Rac interactive binding (CRIB) domain, and has been shown to bind CDC42. It may function as a CDC42 downstream effector mediating CDC42 induced peripheral actin formation, and promoting cytoskeletal reorganization. Multiple alternatively spliced transcript variants have been described, and the full-length nature of two of them has been reported. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: LVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKVESLRQELRRTERAKKELEVHTEALAAEASKDRKLRE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDC42BPA CDC42 binding protein kinase alpha (DMPK-like) [ Homo sapiens ]
• Official Symbol: CDC42BPA
• Synonyms: CDC42BPA; CDC42 binding protein kinase alpha (DMPK-like); CDC42 binding protein kinase alpha (DMPK like); serine/threonine-protein kinase MRCK alpha; FLJ23347; KIAA0451; MRCK; MRCKA; myotonic dystrophy kinase related Cdc42 binding kinase; PK428; MRCK alpha; DMPK-like alpha; ser-thr protein kinase PK428; CDC42 binidng protein kinase beta; myotonic dystrophy protein kinase-like alpha; CDC42-binding protein kinase alpha (DMPK-like); myotonic dystrophy kinase-related CDC42-binding kinase alpha; myotonic dystrophy kinase-related CDC42-binding protein kinase alpha; ser-thr protein kinase related to the myotonic dystrophy protein kinase; DKFZp686L1738; DKFZp686P1738
• Gene ID: 8476
• mRNA Refseq: NM_003607
• Protein Refseq: NP_003598
• MIM: 603412
• UniProt ID: Q5VT25