Recombinant Human CDC26, His-tagged

• Cat.No.: CDC26-27901TH
• Product Overview: Recombinant full length Human Cdc26 / Apc12 with an N terminal His tag; 105 amino acids with tag, MWt 11.9 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 85 amino acids
• Description: The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of various proteins.
• Conjugation: HIS
• Molecular Weight: 11.900kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 40% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF

Gene Information

• Gene Name: CDC26 cell division cycle 26 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: CDC26
• Synonyms: CDC26; cell division cycle 26 homolog (S. cerevisiae); C9orf17, cell division cycle 26 , chromosome 9 open reading frame 17; anaphase-promoting complex subunit CDC26; ANAPC12; anaphase promoting complex subunit 12; APC12; CDC26 subunit of anaphase promo
• Gene ID: 246184
• mRNA Refseq: NM_139286
• Protein Refseq: NP_644815
• Uniprot ID: Q8NHZ8
• Chromosome Location: 9q32
• Pathway: APC/C complex, organism-specific biosystem; APC/C complex, conserved biosystem; APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Cyclin B, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem
• Function: protein binding