Recombinant Human CDC123 protein, T7-tagged

• Cat.No.: CDC123-178H
• Product Overview: Recombinant human CDC123 (336 aa) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: T7
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFMKKEHVLHCQFSAWYPFFRGVTIKSVILPLPQNVKDYLLDDGTLVVSGRDDPPTHSQPDS DDEAEEIQWSDDENTATLTAPEFPEFATKVQEAINSLGGSVFPKLNWSAPRDAYWIAMNSSLKCKTLSDIFLLFK SSDFITRDFTQPFIHCTDDSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEIR RCIQDFFKKHIQYKFLDEDFVFDIYRDSRGKVWLIDFNPFGEVTDSLLFTWEELISENNLNGDFSEVDAQEQDSP AFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in eIF2 regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping CDC123-Chf-Gcd11 axis protein–protein interaction.4. May be used as antigen for specific antibody development and potential biomarker development for type 2 diabetes diagnosis.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
• Protein length: 336 a.a.

Gene Information

• Gene Name: CDC123 cell division cycle 123 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: CDC123
• Synonyms: CDC123; cell division cycle 123 homolog (S. cerevisiae); C10orf7, chromosome 10 open reading frame 7; cell division cycle protein 123 homolog; D123; PZ32; HT-1080; C10orf7; FLJ13863
• Gene ID: 8872
• mRNA Refseq: NM_006023
• Protein Refseq: NP_006014
• UniProt ID: O75794
• Chromosome Location: 10p13