Recombinant Human CD99 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CD99-1744H |
Product Overview : | CD99 MS Standard C13 and N15-labeled recombinant protein (NP_002405) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. There is a related pseudogene located immediately adjacent to this locus. |
Molecular Mass : | 18.8 kDa |
AA Sequence : | MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CD99 CD99 molecule [ Homo sapiens (human) ] |
Official Symbol | CD99 |
Synonyms | CD99; CD99 molecule; antigen identified by monoclonal antibodies 12E7, F21 and O13, CD99 antigen, MIC2; CD99 antigen; E2 antigen; surface antigen MIC2; T-cell surface glycoprotein E2; MIC2 (monoclonal 12E7); antigen identified by monoclonal 12E7, Y homolog; antigen identified by monoclonal antibodies 12E7, F21 and O13; MIC2; HBA71; MIC2X; MIC2Y; MSK5X; |
Gene ID | 4267 |
mRNA Refseq | NM_002414 |
Protein Refseq | NP_002405 |
MIM | 313470 |
UniProt ID | P14209 |
◆ Recombinant Proteins | ||
CD99-1280H | Recombinant Human CD99 protein, His-tagged | +Inquiry |
CD99-4548H | Recombinant Human CD99 Protein (Met1-Asp122), C-His tagged | +Inquiry |
CD99-6941H | Recombinant Human CD99 protein, His & T7-tagged | +Inquiry |
CD99-26953TH | Recombinant Human CD99 Protein, GST-tagged | +Inquiry |
CD99-633HFL | Recombinant Full Length Human CD99 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD99-2203MCL | Recombinant Mouse CD99 cell lysate | +Inquiry |
CD99-1360RCL | Recombinant Rat CD99 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD99 Products
Required fields are marked with *
My Review for All CD99 Products
Required fields are marked with *
0
Inquiry Basket