Recombinant Human CD99 Protein, His-tagged

• Cat.No.: CD99-176H
• Product Overview: Recombinant human CD99 protein with His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 185
• Description: The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. There is a related pseudogene located immediately adjacent to this locus
• Form: Lyophilized
• Molecular Mass: 11 kDa
• AA Sequence: MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: CD99 CD99 molecule [ Homo sapiens (human) ]
• Official Symbol: CD99
• Synonyms: CD99; CD99 molecule; antigen identified by monoclonal antibodies 12E7, F21 and O13 , CD99 antigen , MIC2; CD99 antigen; E2 antigen; surface antigen MIC2; T-cell surface glycoprotein E2; MIC2 (monoclonal 12E7); antigen identified by monoclonal 12E7, Y homolog; antigen identified by monoclonal antibodies 12E7, F21 and O13; MIC2; HBA71; MIC2X; MIC2Y; MSK5X
• Gene ID: 4267
• mRNA Refseq: NM_001122898
• Protein Refseq: NP_001116370
• MIM: 313470
• UniProt ID: P14209