Recombinant Human CD93 protein, His-tagged
Cat.No. : | CD93-5743H |
Product Overview : | Recombinant Human CD93 protein(Q9NPY3)(22-580aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 22-580aa |
Tag : | C-His |
Form : | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 μg/mL can bind Human IGFBP7, the EC50 is 20.34-26.92 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 μg/mL can bind Anti-CD93 recombinant antibody, the EC50 is 0.6639-1.173 ng/mL. |
Molecular Mass : | 60.1 kDa |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | TGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK |
Gene Name | CD93 CD93 molecule [ Homo sapiens ] |
Official Symbol | CD93 |
Synonyms | CD93; CD93 molecule; C1QR1, CD93 antigen , complement component 1, q subcomponent, receptor 1 , matrix remodelling associated 4 , MXRA4; complement component C1q receptor; C1qR(P); C1qRP; CDw93; dJ737E23.1; ECSM3; C1qR; CD93 antigen; C1q receptor 1; C1q/MBL/SPA receptor; matrix-remodelling associated 4; matrix-remodeling-associated protein 4; complement component 1 q subcomponent receptor 1; complement component 1, q subcomponent, receptor 1; C1QR1; MXRA4; |
Gene ID | 22918 |
mRNA Refseq | NM_012072 |
Protein Refseq | NP_036204 |
MIM | 120577 |
UniProt ID | Q9NPY3 |
◆ Recombinant Proteins | ||
Cd93-2066M | Recombinant Mouse Cd93 Protein, Myc/DDK-tagged | +Inquiry |
Cd93-7276M | Recombinant Mouse Cd93 Protein, His-tagged | +Inquiry |
CD93-5743H | Recombinant Human CD93 protein, His-tagged | +Inquiry |
CD93-3102H | Recombinant Human CD93 Protein, MYC/DDK-tagged | +Inquiry |
Cd93-386M | Recombinant Mouse Cd93 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD93-1824HCL | Recombinant Human CD93 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD93 Products
Required fields are marked with *
My Review for All CD93 Products
Required fields are marked with *
0
Inquiry Basket