Recombinant Human CD93 protein, His-tagged

• Cat.No.: CD93-5743H
• Product Overview: Recombinant Human CD93 protein(Q9NPY3)(22-580aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 22-580aa
• Tag: C-His
• Form: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 μg/mL can bind Human IGFBP7, the EC50 is 20.34-26.92 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 μg/mL can bind Anti-CD93 recombinant antibody, the EC50 is 0.6639-1.173 ng/mL.
• Molecular Mass: 60.1 kDa
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: TGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK

Gene Information

• Gene Name: CD93 CD93 molecule [ Homo sapiens ]
• Official Symbol: CD93
• Synonyms: CD93; CD93 molecule; C1QR1, CD93 antigen , complement component 1, q subcomponent, receptor 1 , matrix remodelling associated 4 , MXRA4; complement component C1q receptor; C1qR(P); C1qRP; CDw93; dJ737E23.1; ECSM3; C1qR; CD93 antigen; C1q receptor 1; C1q/MBL/SPA receptor; matrix-remodelling associated 4; matrix-remodeling-associated protein 4; complement component 1 q subcomponent receptor 1; complement component 1, q subcomponent, receptor 1; C1QR1; MXRA4
• Gene ID: 22918
• mRNA Refseq: NM_012072
• Protein Refseq: NP_036204
• MIM: 120577
• UniProt ID: Q9NPY3