Recombinant Human CD93 Protein, GST-Tagged

• Cat.No.: CD93-0884H
• Product Overview: Human CD93 partial ORF (NP_036204, 33 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a cell-surface glycoprotein and type I membrane protein that was originally identified as a myeloid cell-specific marker. The encoded protein was once thought to be a receptor for C1q, but now is thought to instead be involved in intercellular adhesion and in the clearance of apoptotic cells. The intracellular cytoplasmic tail of this protein has been found to interact with moesin, a protein known to play a role in linking transmembrane proteins to the cytoskeleton and in the remodelling of the cytoskeleton. [provided by RefSeq, Jul 2008]
• Molecular Mass: 37.62 kDa
• AA Sequence: GTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CD93 CD93 molecule [ Homo sapiens ]
• Official Symbol: CD93
• Synonyms: CD93; CD93 molecule; C1QR1, CD93 antigen, complement component 1, q subcomponent, receptor 1, matrix remodelling associated 4, MXRA4; complement component C1q receptor; C1qR(P); C1qRP; CDw93; dJ737E23.1; ECSM3; C1qR; CD93 antigen; C1q receptor 1; C1q/MBL/SPA receptor; matrix-remodelling associated 4; matrix-remodeling-associated protein 4; complement component 1 q subcomponent receptor 1; complement component 1, q subcomponent, receptor 1; C1QR1; MXRA4
• Gene ID: 22918
• mRNA Refseq: NM_012072
• Protein Refseq: NP_036204
• MIM: 120577
• UniProt ID: Q9NPY3