Recombinant Human CD9 protein(121-190 aa), C-His-tagged

• Cat.No.: CD9-2693H
• Product Overview: Recombinant Human CD9 protein(P21926)(121-190 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 121-190 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: VQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFD
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: CD9 CD9 molecule [ Homo sapiens ]
• Official Symbol: CD9
• Synonyms: CD9; CD9 molecule; CD9 antigen (p24) , MIC3; CD9 antigen; BA2; motility related protein 1; MRP 1; P24; TSPAN29; 5H9 antigen; tetraspanin-29; BA-2/p24 antigen; CD9 antigen (p24); leukocyte antigen MIC3; motility related protein-1; cell growth-inhibiting gene 2 protein; MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN-29; FLJ99568
• Gene ID: 928
• mRNA Refseq: NM_001769
• Protein Refseq: NP_001760
• MIM: 143030
• UniProt ID: P21926