Recombinant Mouse Cd9 protein, His&Myc-tagged
Cat.No. : | Cd9-6643M |
Product Overview : | Recombinant Mouse Cd9 protein(P40240)(110-193aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 110-193a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | THKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHI |
Gene Name | Cd9 CD9 antigen [ Mus musculus ] |
Official Symbol | Cd9 |
Synonyms | CD9; CD9 antigen; Tspan29; |
Gene ID | 12527 |
mRNA Refseq | NM_007657 |
Protein Refseq | NP_031683 |
◆ Recombinant Proteins | ||
Cd9-852M | Recombinant Mouse Cd9 Protein, MYC/DDK-tagged | +Inquiry |
Cd9-1333M | Recombinant Mouse Cd9 Full Length Transmembrane protein, His-tagged | +Inquiry |
CD9-79HFL | Active Recombinant Full Length Human CD9 Protein, C-Flag-tagged | +Inquiry |
CD9-1472M | Recombinant Mouse CD9 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD9-06H | Recombinant Human CD9 Protein, hIgG/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD9-2110HCL | Recombinant Human CD9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cd9 Products
Required fields are marked with *
My Review for All Cd9 Products
Required fields are marked with *
0
Inquiry Basket