Recombinant Human CD8B Protein, C-His-tagged

• Cat.No.: CD8B-177H
• Product Overview: Recombinant Human CD8B Protein with C-His tag was expressed in E. coli.

Specification

• Description: The T cell receptor (TCR) is a heterodimer composed of either a and b or γ and δ chains. CD3 chains and the CD4 or CD8 co-receptors are also required for efficient signal transduction through the TCR. The TCR is expressed on T helper and T cytotoxic cells that can be distinguished by their expression of CD4 and CD8. T helper cells express CD4 proteins and T cytotoxic cells display CD8. CD8 (also designated Leu 2 or T8), a cell surface glycoprotein, is a two chain complex (aa or ab) receptor that binds class I MHC molecules presented by the antigen-presenting cell (APC). A primary function of CD8 is to facilitate antigen recognition by the TCR and to strengthen the avidity of the TCR-antigen interactions. An additional role for CD8-expressing T cells may be to maintain low levels of HIV expression.
• Source: E. coli
• Species: Human
• Tag: His
• Molecular Mass: ~16 kDa
• AA Sequence: LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: CD8B CD8b molecule [ Homo sapiens (human) ]
• Official Symbol: CD8B
• Synonyms: CD8B; CD8b molecule; CD8 antigen, beta polypeptide 1 (p37) , CD8B1; T-cell surface glycoprotein CD8 beta chain; CD8 antigen, beta polypeptide 1 (p37); T lymphocyte surface glycoprotein beta chain; LY3; P37; LEU2; LYT3; CD8B1; MGC119115
• Gene ID: 926
• mRNA Refseq: NM_001178100
• Protein Refseq: NP_001171571
• MIM: 186730
• UniProt ID: P10966