Recombinant Human CD86 Protein, His-Flag-StrepII-Tagged
Cat.No. : | CD86-0873H |
Product Overview : | Purified CD86 (AAH40261.1, 24 a.a. - 246 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Flag&His&Strep II |
Protein Length : | 24-246 a.a. |
Description : | This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms.[provided by RefSeq, May 2011] |
Form : | Liquid |
Bio-activity : | Not Tested |
Molecular Mass : | 29.81 kDa |
AA Sequence : | APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHI |
Applications : | Western Blot Enzyme-linked Immunoabsorbent Assay SDS-PAGE Protein Interaction |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | ≥ 10 μg/mL |
Storage Buffer : | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
Gene Name | CD86 CD86 molecule [ Homo sapiens ] |
Official Symbol | CD86 |
Synonyms | CD86; CD86 molecule; CD28LG2, CD86 antigen (CD28 antigen ligand 2, B7 2 antigen); T-lymphocyte activation antigen CD86; B lymphocyte antigen B7 2; B7 2; B7.2; BU63; FUN-1; CTLA-4 counter-receptor B7.2; B-lymphocyte activation antigen B7-2; CD86 antigen (CD28 antigen ligand 2, B7-2 antigen); B70; B7-2; LAB72; CD28LG2; MGC34413; |
Gene ID | 942 |
mRNA Refseq | NM_001206924 |
Protein Refseq | NP_001193853 |
MIM | 601020 |
UniProt ID | P42081 |
◆ Recombinant Proteins | ||
CD86-253H | Recombinant Human CD86 Protein, DYKDDDDK-tagged | +Inquiry |
CD86-578R | Recombinant Rhesus Macaque CD86 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD86-595H | Recombinant Human CD86 Protein, Fc-tagged | +Inquiry |
CD86-2228H | Recombinant Human CD86, His tagged | +Inquiry |
CD86-138CAF647 | Recombinant Monkey CD86 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD86-1013CCL | Recombinant Cynomolgus CD86 cell lysate | +Inquiry |
CD86-2598MCL | Recombinant Mouse CD86 cell lysate | +Inquiry |
CD86-2619HCL | Recombinant Human CD86 cell lysate | +Inquiry |
CD86-1971RCL | Recombinant Rat CD86 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD86 Products
Required fields are marked with *
My Review for All CD86 Products
Required fields are marked with *
0
Inquiry Basket