Recombinant Human CD86 Protein, His-Flag-StrepII-Tagged

• Cat.No.: CD86-0873H
• Product Overview: Purified CD86 (AAH40261.1, 24 a.a. - 246 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.

Specification

• Description: This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms.[provided by RefSeq, May 2011]
• Source: Human cells
• Species: Human
• Tag: His&Flag&StrepII
• Form: Liquid
• Bio-activity: Not Tested
• Molecular Mass: 29.81 kDa
• AA Sequence: APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHI
• Applications: Western Blot
  Enzyme-linked Immunoabsorbent Assay
  SDS-PAGE
  Protein Interaction
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: ≥ 10 μg/mL
• Storage Buffer: 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
• Protein length: 24-246 a.a.

Gene Information

• Gene Name: CD86 CD86 molecule [ Homo sapiens ]
• Official Symbol: CD86
• Synonyms: CD86; CD86 molecule; CD28LG2, CD86 antigen (CD28 antigen ligand 2, B7 2 antigen); T-lymphocyte activation antigen CD86; B lymphocyte antigen B7 2; B7 2; B7.2; BU63; FUN-1; CTLA-4 counter-receptor B7.2; B-lymphocyte activation antigen B7-2; CD86 antigen (CD28 antigen ligand 2, B7-2 antigen); B70; B7-2; LAB72; CD28LG2; MGC34413
• Gene ID: 942
• mRNA Refseq: NM_001206924
• Protein Refseq: NP_001193853
• MIM: 601020
• UniProt ID: P42081