Recombinant Human CD83 protein, GST-tagged

• Cat.No.: CD83-301473H
• Product Overview: Recombinant Human CD83 (22-144 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Glu22-Glu144
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: EVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAE
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: CD83 CD83 molecule [ Homo sapiens ]
• Official Symbol: CD83
• Synonyms: CD83; CD83 molecule; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily) , CD83 molecule; CD83 antigen; BL11; HB15; hCD83; B-cell activation protein; cell surface protein HB15; cell-surface glycoprotein; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily)
• Gene ID: 9308
• mRNA Refseq: NM_001040280
• Protein Refseq: NP_001035370
• MIM: 604534
• UniProt ID: Q01151