Recombinant Human CD81 Protein, GST-Tagged
Cat.No. : | CD81-0866H |
Product Overview : | Human CD81 partial ORF (AAH02978, 25 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
Molecular Mass : | 36.96 kDa |
AA Sequence : | GGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD81 CD81 molecule [ Homo sapiens ] |
Official Symbol | CD81 |
Synonyms | CD81; CD81 molecule; CD81 antigen (target of antiproliferative 1), TAPA1; CD81 antigen; TAPA 1; TSPAN28; tspan-28; tetraspanin-28; 26 kDa cell surface protein TAPA-1; CD81 antigen (target of antiproliferative 1); S5.7; CVID6; TAPA1; |
Gene ID | 975 |
mRNA Refseq | NM_004356 |
Protein Refseq | NP_004347 |
MIM | 186845 |
UniProt ID | P60033 |
◆ Recombinant Proteins | ||
CD81-1263R | Recombinant Rat CD81 Protein | +Inquiry |
RFL33103BF | Recombinant Full Length Bovine Cd81 Antigen(Cd81) Protein, His-Tagged | +Inquiry |
CD81-0527H | Active Recombinant Human CD81 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
CD81-548H | Recombinant Human CD81 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL30843CF | Recombinant Full Length Chlorocebus Aethiops Cd81 Antigen(Cd81) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD81-848HCL | Recombinant Human CD81 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD81 Products
Required fields are marked with *
My Review for All CD81 Products
Required fields are marked with *
0
Inquiry Basket