Recombinant Human CD81 Protein, GST-Tagged

• Cat.No.: CD81-0866H
• Product Overview: Human CD81 partial ORF (AAH02978, 25 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.96 kDa
• AA Sequence: GGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CD81 CD81 molecule [ Homo sapiens ]
• Official Symbol: CD81
• Synonyms: CD81; CD81 molecule; CD81 antigen (target of antiproliferative 1), TAPA1; CD81 antigen; TAPA 1; TSPAN28; tspan-28; tetraspanin-28; 26 kDa cell surface protein TAPA-1; CD81 antigen (target of antiproliferative 1); S5.7; CVID6; TAPA1
• Gene ID: 975
• mRNA Refseq: NM_004356
• Protein Refseq: NP_004347
• MIM: 186845
• UniProt ID: P60033