Recombinant Human CD79A Protein, His-Flag-StrepII-Tagged

• Cat.No.: CD79A-0856H
• Product Overview: Purified CD79A (NP_001774.1, 33 a.a. - 143 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.

Specification

• Description: The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
• Source: Human cells
• Species: Human
• Tag: His&Flag&StrepII
• Form: Liquid
• Bio-activity: Not Tested
• Molecular Mass: 15.29 kDa
• AA Sequence: LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: ≥ 10 μg/mL
• Storage Buffer: 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
• Protein length: 33-143 a.a.

Gene Information

• Gene Name: CD79A CD79a molecule, immunoglobulin-associated alpha [ Homo sapiens ]
• Official Symbol: CD79A
• Synonyms: CD79A; CD79a molecule, immunoglobulin-associated alpha; CD79A antigen (immunoglobulin associated alpha), IGA; B-cell antigen receptor complex-associated protein alpha chain; MB 1; ig-alpha; MB-1 membrane glycoprotein; surface IgM-associated protein; CD79a antigen (immunoglobulin-associated alpha); membrane-bound immunoglobulin-associated protein; IGA; MB-1
• Gene ID: 973
• mRNA Refseq: NM_001783
• Protein Refseq: NP_001774
• MIM: 112205
• UniProt ID: P11912