Recombinant Human CD79A Protein, His-Flag-StrepII-Tagged
Cat.No. : | CD79A-0856H |
Product Overview : | Purified CD79A (NP_001774.1, 33 a.a. - 143 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Flag&His&Strep II |
Protein Length : | 33-143 a.a. |
Description : | The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
Form : | Liquid |
Bio-activity : | Not Tested |
Molecular Mass : | 15.29 kDa |
AA Sequence : | LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | ≥ 10 μg/mL |
Storage Buffer : | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
Gene Name | CD79A CD79a molecule, immunoglobulin-associated alpha [ Homo sapiens ] |
Official Symbol | CD79A |
Synonyms | CD79A; CD79a molecule, immunoglobulin-associated alpha; CD79A antigen (immunoglobulin associated alpha), IGA; B-cell antigen receptor complex-associated protein alpha chain; MB 1; ig-alpha; MB-1 membrane glycoprotein; surface IgM-associated protein; CD79a antigen (immunoglobulin-associated alpha); membrane-bound immunoglobulin-associated protein; IGA; MB-1; |
Gene ID | 973 |
mRNA Refseq | NM_001783 |
Protein Refseq | NP_001774 |
MIM | 112205 |
UniProt ID | P11912 |
◆ Recombinant Proteins | ||
Cd79a-904MP | Recombinant Mouse Cd79a protein, Fc-tagged, R-PE labeled | +Inquiry |
Cd79a-6888M | Recombinant Mouse Cd79a protein, His & T7-tagged | +Inquiry |
CD79A-151H | Recombinant Human CD79A Protein, DYKDDDDK-tagged | +Inquiry |
CD79A-27509TH | Recombinant Human CD79A | +Inquiry |
Cd79a-904MAF555 | Recombinant Mouse Cd79a Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD79A-7673HCL | Recombinant Human CD79A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD79A Products
Required fields are marked with *
My Review for All CD79A Products
Required fields are marked with *
0
Inquiry Basket