Recombinant Human CD79A

• Cat.No.: CD79A-27509TH
• Product Overview: Recombinant fragment (amino acids 33-140) of Human CD79a with proprietary 26 kDa tag; 108 amino acids (Predicted MW 12.16 kDa), 37.51 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 108 amino acids
• Description: The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.
• Molecular Weight: 37.510kDa inclusive of tags
• Tissue specificity: B-cells.
• Biological activity: useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HClNote: Glutathione is reduced
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGT
• Sequence Similarities: Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 ITAM domain.

Gene Information

• Gene Name: CD79A CD79a molecule, immunoglobulin-associated alpha [ Homo sapiens ]
• Official Symbol: CD79A
• Synonyms: CD79A; CD79a molecule, immunoglobulin-associated alpha; CD79A antigen (immunoglobulin associated alpha) , IGA; B-cell antigen receptor complex-associated protein alpha chain; MB 1
• Gene ID: 973
• mRNA Refseq: NM_001783
• Protein Refseq: NP_001774
• MIM: 112205
• Uniprot ID: P11912
• Chromosome Location: 19q13.2
• Pathway: B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem; Primary immunodeficiency, organism-specific biosystem
• Function: transmembrane signaling receptor activity