Recombinant Human CD72 Protein, GST-Tagged

• Cat.No.: CD72-0853H
• Product Overview: Human CD72 full-length ORF (AAH30227.1, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CD72 (CD72 Molecule) is a Protein Coding gene. Diseases associated with CD72 include Small Intestine Lymphoma and Chronic Lymphocytic Leukemia. Among its related pathways are Natural Killer Cell Receptors: Human Target Cell – NK Cell Ligand-Receptor Interactions and Developmental Biology. GO annotations related to this gene include receptor binding and carbohydrate binding.
• Molecular Mass: 65.89 kDa
• AA Sequence: MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQPTASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CD72 CD72 molecule [ Homo sapiens ]
• Official Symbol: CD72
• Synonyms: CD72; CD72 molecule; CD72 antigen; B-cell differentiation antigen CD72; CD72b; LYB2; lyb-2
• Gene ID: 971
• mRNA Refseq: NM_001782
• Protein Refseq: NP_001773
• MIM: 107272
• UniProt ID: P21854