Recombinant Human CD72 Protein, Fc-tagged

• Cat.No.: CD72-169H
• Product Overview: Recombinant human CD72 protein with Fc tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc
• ProteinLength: 359
• Description: Predicted to enable signaling receptor binding activity. Predicted to be involved in cell adhesion. Is integral component of plasma membrane.
• Form: Lyophilized
• Molecular Mass: 54 kDa
• AA Sequence: MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQPTASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: CD72 CD72 molecule [ Homo sapiens (human) ]
• Official Symbol: CD72
• Synonyms: CD72; CD72 molecule; CD72 antigen; B-cell differentiation antigen CD72; CD72b; LYB2; lyb-2
• Gene ID: 971
• mRNA Refseq: NM_001782
• Protein Refseq: NP_001773
• MIM: 107272
• UniProt ID: P21854