Recombinant Human CD70 molecule Protein, His tagged
Cat.No. : | CD70-001H |
Product Overview : | Recombinant Human CD70 Protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 45-193 aa |
Description : | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. |
Tag : | C-His |
Molecular Mass : | 18 kDa |
AA Sequence : | QQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRPHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 0.75 mg/mL by BCA |
Gene Name | CD70 CD70 molecule [ Homo sapiens (human) ] |
Official Symbol | CD70 |
Synonyms | CD70; CD70 molecule; CD27LG, TNFSF7, tumor necrosis factor (ligand) superfamily, member 7; CD70 antigen; CD27L; CD27-L; CD27 ligand; Ki-24 antigen; surface antigen CD70; tumor necrosis factor ligand superfamily member 7; tumor necrosis factor (ligand) superfamily, member 7; CD27LG; TNFSF7 |
Gene ID | 970 |
mRNA Refseq | NM_001252 |
Protein Refseq | NP_001243 |
MIM | 602840 |
UniProt ID | P32970 |
◆ Recombinant Proteins | ||
CD70-218H | Active Recombinant Human CD70 Protein, HA/GCN4-IZ-tagged | +Inquiry |
CD70-116H | Active Recombinant Human CD70, His-tagged | +Inquiry |
CD70-434H | Recombinant Human CD70 protein, His-Flag-tagged | +Inquiry |
CD70-1805R | Recombinant Rhesus Monkey CD70 Protein, hIgG1-tagged | +Inquiry |
CD70-0848H | Recombinant Human CD70 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD70-2710HCL | Recombinant Human CD70 cell lysate | +Inquiry |
CD70-1303RCL | Recombinant Rat CD70 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD70 Products
Required fields are marked with *
My Review for All CD70 Products
Required fields are marked with *
0
Inquiry Basket