Recombinant Human CD7 protein, His-SUMO-tagged
Cat.No. : | CD7-2671H |
Product Overview : | Recombinant Human CD7 protein(P09564)(26-180aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 26-180aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.4 kDa |
AA Sequence : | AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CD7 CD7 molecule [ Homo sapiens ] |
Official Symbol | CD7 |
Synonyms | CD7; CD7 molecule; CD7 antigen (p41); T-cell antigen CD7; GP40; LEU 9; p41 protein; T cell antigen CD7; T cell leukemia antigen; Tp40; TP41; T-cell leukemia antigen; T-cell surface antigen Leu-9; LEU-9; |
Gene ID | 924 |
mRNA Refseq | NM_006137 |
Protein Refseq | NP_006128 |
MIM | 186820 |
UniProt ID | P09564 |
◆ Recombinant Proteins | ||
CD7-3008H | Active Recombinant Human CD7 protein, lFc-tagged, FITC-Labeled | +Inquiry |
Cd7-2280M | Recombinant Mouse CD7 protein(Met1-Pro150), His-tagged | +Inquiry |
CD7-80HF | Recombinant Full Length Human CD7 Protein | +Inquiry |
CD7-696H | Recombinant Human CD7 Protein, His-tagged | +Inquiry |
CD7-3004H | Active Recombinant Human CD7 Protein, His-tagged, Site-specific PE-Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD7-2518MCL | Recombinant Mouse CD7 cell lysate | +Inquiry |
CD7-2607HCL | Recombinant Human CD7 cell lysate | +Inquiry |
CD7-1368RCL | Recombinant Rat CD7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD7 Products
Required fields are marked with *
My Review for All CD7 Products
Required fields are marked with *
0
Inquiry Basket