Recombinant Full Length Human CD7 Protein

Cat.No. : CD7-80HF
Product Overview : Recombinant full length mature Human CD7 with a N terminal proprietary tag; Predicted MWt 50.31 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 220 amino acids
Description : This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development.
Form : Liquid
Molecular Mass : 50.310kDa inclusive of tags
AA Sequence : PGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLR QLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTIT MHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWH RCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP AALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACV VYEDMSHSRCNTLSSPNQYQ
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name CD7 CD7 molecule [ Homo sapiens ]
Official Symbol CD7
Synonyms CD7; CD7 molecule; CD7 antigen (p41); T-cell antigen CD7; GP40; LEU 9; p41 protein; T cell antigen CD7; T cell leukemia antigen; Tp40; TP41
Gene ID 924
mRNA Refseq NM_006137
Protein Refseq NP_006128
MIM 186820
UniProt ID P09564

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD7 Products

Required fields are marked with *

My Review for All CD7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon