Recombinant Human CD63 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CD63-1382H |
Product Overview : | CD63 MS Standard C13 and N15-labeled recombinant protein (NP_001771) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms. |
Molecular Mass : | 25.6 kDa |
AA Sequence : | MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CD63 CD63 molecule [ Homo sapiens (human) ] |
Official Symbol | CD63 |
Synonyms | CD63; CD63 molecule; CD63 antigen (melanoma 1 antigen), MLA1; CD63 antigen; ME491; TSPAN30; tspan-30; granulophysin; tetraspanin-30; melanoma-associated antigen MLA1; CD63 antigen (melanoma 1 antigen); melanoma-associated antigen ME491; ocular melanoma-associated antigen; lysosomal-associated membrane protein 3; lysosome-associated membrane glycoprotein 3; MLA1; LAMP-3; OMA81H; |
Gene ID | 967 |
mRNA Refseq | NM_001780 |
Protein Refseq | NP_001771 |
MIM | 155740 |
UniProt ID | P08962 |
◆ Recombinant Proteins | ||
CD63-1261R | Recombinant Rat CD63 protein, His-tagged | +Inquiry |
CD63-3584H | Recombinant Human CD63 protein, His-tagged | +Inquiry |
CD63-3017HF | Recombinant Full Length Human CD63 Protein | +Inquiry |
RFL36047RF | Recombinant Full Length Rat Cd63 Antigen(Cd63) Protein, His-Tagged | +Inquiry |
RFL3211OF | Recombinant Full Length Rabbit Cd63 Antigen(Cd63) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD63-1553SCL | Recombinant Sus scrofa (Pig) CD63 cell lysate | +Inquiry |
CD63-814CCL | Recombinant Cynomolgus CD63 cell lysate | +Inquiry |
CD63-001RCL | Recombinant Rat CD63 cell lysate | +Inquiry |
CD63-1913HCL | Recombinant Human CD63 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD63 Products
Required fields are marked with *
My Review for All CD63 Products
Required fields are marked with *
0
Inquiry Basket